Western blot analysis of extracts of mouse lung cells.
SRSF2 / SC35 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408726-20
Catalog Number: LS-C408726
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SC35 antibody LS-C408726 is an unconjugated rabbit polyclonal antibody to SC35 (SRSF2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PR264 | Protein PR264 | SFRS2 | Splicing component, 35 kDa | Splicing factor sc35 | SR splicing factor 2 | SRSF2 | SRp30b | SC35 | SC-35 | SFRS2A
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q01130
- NCBI GenBank
- NM_003016 | NP_003007.2
- SwissProt
- Q01130
Target
- Target
- Human SRSF2 / SC35
- Antigen Species
- Human
- Epitope
- Human SRSF2 / SC35
- Gene Name
- SRSF2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human SRSF2 (NP_003007.2). MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS