Osteopontin antibody Western blot. All lanes: Anti Osteopontin at 0.5 ug/ml. Lane 1: Mouse Pancreas Tissue Lysate at 50 ug. Lane 2: JURKAT Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 66 kD. Observed band size: 66 kD.
SPP1 / Osteopontin Antibody (aa281-314)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408135-100
Catalog Number: LS-C408135
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Osteopontin antibody LS-C408135 is an unconjugated rabbit polyclonal antibody to Osteopontin (SPP1) (aa281-314) from human. It is reactive with human, mouse and rat. Validated for ELISA and WB.
- Application
- ELISA, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BSPI | BNSP | Bone sialoprotein 1 | ETA-1 | Nephropontin | OPN | Secreted phosphoprotein 1 | SPP-1 | SPP1/CALPHA1 fusion | Urinary stone protein | Uropontin | Osteopontin | Bone sialoprotein I | SPP1
- Recommended Dilution: ELISA
- 0.1 - 0.5 ug/ml
- UniProt Number
- P10451
- NCBI GenBank
- NM_000582, NP_000573.1
- SwissProt
- P10451
Target
- Target
- Human SPP1 / Osteopontin
- Antigen Species
- Hu
- Epitope
- Bone. Found in plasma.
- Gene Name
- SPP1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Osteopontin (281-314 aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl