Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
SPO11 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C410642-20
Catalog Number: LS-C410642
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SPO11 antibody LS-C410642 is an unconjugated rabbit polyclonal antibody to rat SPO11. Validated for WB.
- Application
- WB
- Reactivity
- Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cancer/testis antigen 35 | CT35 | SPO11
- Recommended Dilution: WB
- 1:200 - 1:2000
- UniProt Number
- Q9Y5K1
- NCBI GenBank
- NM_012444 | NP_036576.1
- SwissProt
- Q9Y5K1
Target
- Target
- Human SPO11
- Antigen Species
- Human
- Epitope
- Human SPO11
- Gene Name
- SPO11
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 269-358 of human SPO11 (NP_937998.1). AIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
