Western blot analysis of extracts of mouse heart, using SOX7 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

SOX7 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C749919-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SOX7 antibody LS-C749919 is an unconjugated rabbit polyclonal antibody to SOX7 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Transcription factor SOX-7 | SOX7 transcription factor | SOX7
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9BT81
NCBI GenBank: NM_031439 | NP_113627.1
SwissProt: Q9BT81

Target

Target: Human SOX7
Antigen Species: Human
Gene Name: SOX7

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SOX7 (NP_113627.1). PLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMA
Immunogen Type: Synthetic Peptide (Linear)