Western blot analysis of SMYD3 expression in HELA whole cell lysates (lane 1) and COLO320 whole cell lysates (lane 2). SMYD3 at 55 kD was detected using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

SMYD3 Antibody (aa388-428)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Dog, Horse, Human, Pig, Rabbit
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408105-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SMYD3 antibody LS-C408105 is an unconjugated rabbit polyclonal antibody to SMYD3 (aa388-428) from human. It is reactive with human, dog, horse and other species. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Can, Hr, Hu, Por, Rb
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: BA74P14.1 | BA74P14.1 (novel protein) | KMT3E | SMYD3 | ZMYND1 | ZNFN3A1
UniProt Number: Q9H7B4
NCBI GenBank: NM_022743 | NP_073580.1
SwissProt: Q9H7B4

Target

Target: Human SMYD3
Antigen Species: Human
Epitope: Expressed in skeletal muscles and testis. Overexpressed in a majority of colorectal and hepatocellular carcinomas. .
Gene Name: SMYD3

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human SMYD3 (388-428 aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS), different from the related mouse sequence by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl