IHC analysis of SMC3 using anti-SMC3 antibody. SMC3 was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-SMC3 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
SMC3 / HCAP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756654-100
Catalog Number: LS-C756654
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HCAP antibody LS-C756654 is an unconjugated mouse monoclonal antibody to HCAP (SMC3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- Bamacan | CDLS3 | CSPG6 | HCAP | SMC-3 | SMC3 | BAM | BMH | SMC protein 3 | SMC3L1
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- Q9UQE7
- NCBI GenBank
- NM_005445 | NP_005436.1
- SwissProt
- Q9UQE7
Target
- Target
- Human SMC3 / HCAP
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- SMC3
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Isotype
- IgG1
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SMC3(1178-1216 aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl