SMC3 antibody Western blot. All lanes: Anti SMC3 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: Rat Testis Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: A549 Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Lane 7: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 140 kD. Observed band size: 140 kD.
SMC3 / HCAP Antibody (aa1178-1216)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Chicken, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407958-100
Catalog Number: LS-C407958
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HCAP antibody LS-C407958 is an unconjugated rabbit polyclonal antibody to HCAP (SMC3) (aa1178-1216) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Ck, GP, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Bamacan | CDLS3 | CSPG6 | HCAP | SMC-3 | SMC3 | BAM | BMH | SMC protein 3 | SMC3L1
- UniProt Number
- Q9UQE7
- NCBI GenBank
- NM_005445 | NP_005436.1
- SwissProt
- Q9UQE7
Target
- Target
- Human SMC3 / HCAP
- Antigen Species
- Human
- Gene Name
- SMC3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SMC3 (1178-1216 aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl