
Western blot analysis of extracts of various cell lines, using SLC6A2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
SLC6A2 / NET Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408311-20
Catalog Number: LS-C408311
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NET antibody LS-C408311 is an unconjugated rabbit polyclonal antibody to NET (SLC6A2) from human. It is reactive with human, mouse and rat. Validated for WB. Cited in 1 publication.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- NET | Neurotransmitter transporter | SLC6A2 | Noradrenaline transporter | Norepinephrine transporter
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P23975
- NCBI GenBank
- NM_001043 | NP_001034.1
- SwissProt
- P23975
Target
- Target
- Human SLC6A2 / NET
- Antigen Species
- Human
- Epitope
- Human SLC6A2 / NET
- Gene Name
- SLC6A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC6A2 (NP_001165975.1). MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 3.98 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
Activation of glucagon-like peptide-1 receptors reduces the acquisition of aggression-like behaviors in male mice. Jesper Vestlund, Qian Zhang, Olesya T Shevchouk, Daniel Hovey, Lundström Sebastian, Lars Westberg, Elisabet Jerlhag. Translational psychiatry. 2022 October;12:445. PubMed: 36229445 PMC: PMC9561171
