Western blot testing of 1) rat brain and 2) mouse brain lysate with GAT-1 antibody at 0.5ug/ml. Predicted molecular weight: 67~80 kDa depending on level of glycosylation.
SLC6A1 / GAT-1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782839-100
Catalog Number: LS-C782839
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GAT-1 antibody LS-C782839 is an unconjugated rabbit polyclonal antibody to GAT-1 (SLC6A1) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GABA transporter | GABA transporter 1 | GABT1 | GAT1 | GABATHG | GABATR | GAT-1 | SLC6A1 | GAT 1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P30531
- NCBI GenBank
- NM_003042 | NP_003033.3
- SwissProt
- P30531
Target
- Target
- Mouse SLC6A1 / GAT-1
- Antigen Species
- Mouse
- Gene Name
- SLC6A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 23-54 (ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL) were used as the immunogen for the GAT-1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS