Western blot analysis of extracts of various cell lines, using SLC4A10 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

SLC4A10 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C748839-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SLC4A10 antibody LS-C748839 is an unconjugated rabbit polyclonal antibody to SLC4A10 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: NBCn2 | NCBE | SLC4A10
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q6U841
NCBI GenBank: NM_022058
SwissProt: Q6U841

Target

Target: Human SLC4A10
Antigen Species: Hu
Gene Name: SLC4A10

Antibody

Host Species: Rb
Clonality: Polyclonal
Isotype: IgG
Origin Species: Hu

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human SLC4A10 (NP_001171486.1). ALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHPYVPDV
Immunogen Type: Fusion-P

Format

Conjugate/Label: Unconj
Format: Liquid
Formulation: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Volume: 20 Microliter
Preservative: Yes
Purification Method: AP

Storage & Handling

Storage Conditions: Store at -20°C. Avoid freeze-thaw cycles.
Recommended Storage Buffer: PBS

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.