Western blot analysis of extracts of various cell lines, using SLC46A2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

SLC46A2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C750468-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SLC46A2 antibody LS-C750468 is an unconjugated rabbit polyclonal antibody to SLC46A2 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Ly110 | SLC46A2 | Thymic stromal co-transporter | TSCOT
Recommended Dilution: WB: 1:200 - 1:2000
UniProt Number: Q9BY10
NCBI GenBank: NM_033051 | NP_149040.3
SwissProt: Q9BY10

Target

Target: Human SLC46A2
Antigen Species: Human
Gene Name: SLC46A2

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC46A2 (NP_149040.3). MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISIC
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)