
Western blot testing of human 1) HEK293 and 2) K562 cell lysate with SLC34A2 antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa, but may be observed at up to ~130 kDa due to glycosylation.
SLC34A2 / NaPi-2b Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782282-100
Catalog Number: LS-C782282
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NaPi-2b antibody LS-C782282 is an unconjugated rabbit polyclonal antibody to NaPi-2b (SLC34A2) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 1 publication.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- NaPi-2b | NAPI-IIb | NAPI-3B | Na(+)/Pi cotransporter 2B | NaPi3b | NPTIIb | SLC34A2
- UniProt Number
- O95436
- NCBI GenBank
- NM_006424
- SwissProt
- O95436
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human SLC34A2 / NaPi-2b
- Antigen Species
- Human
- Gene Name
- SLC34A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein were used as the immunogen for the SLC34A2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
High-phytate/low-calcium diet is a risk factor for crystal nephropathies, renal phosphate wasting, and bone loss. Ok-Hee Kim, Carmen J Booth, Han Seok Choi, Jinwook Lee, Jinku Kang, June Hur, Woo Jin Jung, Yun-Shin Jung, Hyung Jin Choi, Hyeonjin Kim, Joong-Hyuck Auh, Jung-Wan Kim, Ji-Young Cha, Young Jae Lee, Cheol Soon Lee, Cheolsoo Choi, Yun Jae Jung, Jun-Young Yang, Seung-Soon Im, Dae Ho Lee, Sun Wook Cho, Young-Bum Kim, Kyong Soo Park, Young Joo Park, Byung-Chul Oh. eLife. 2020 Apr;9:e52709. PubMed: 32271147 PMC: PMC7145417
