Western blot testing of human 1) HepG2 and 2) PANC-1 cell lysate with CTR1 antibody at 0.5ug/ml. Expected molecular weight ~25 kDa (unmodified), 35-37 kDa (glycosylated).
SLC31A1 / CTR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782114-100
Catalog Number: LS-C782114
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CTR1 antibody LS-C782114 is an unconjugated rabbit polyclonal antibody to human CTR1 (SLC31A1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- COPT1 | CTR1 | Copper transport 1 homolog | Copper transporter 1 | HCTR1 | SLC31A1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- O15431
- NCBI GenBank
- NM_001859 | NP_001850.1
- SwissProt
- O15431
Target
- Target
- Human SLC31A1 / CTR1
- Antigen Species
- Human
- Gene Name
- SLC31A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ were used as the immunogen for the CTR1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS