Western blot testing of human 1) HK-2 and 2) 293T cell lysate with Pendrin antibody at 0.5ug/ml. Predicted molecular weight ~86 kDa.
SLC26A4 / Pendrin Antibody (aa674-705)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782100-100
Catalog Number: LS-C782100
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Pendrin antibody LS-C782100 is an unconjugated rabbit polyclonal antibody to human Pendrin (SLC26A4) (aa674-705). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DFNB4 | EVA | Pendrin | PDS | SLC26A4 | TDH2B
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- O43511
- NCBI GenBank
- NM_000441 | NP_000432.1
- SwissProt
- O43511
Target
- Target
- Human SLC26A4 / Pendrin
- Antigen Species
- Human
- Gene Name
- SLC26A4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ were used as the immunogen for the Pendrin antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS