
SLC24A5 / NCKX5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750195-20
Catalog Number: LS-C750195
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NCKX5 antibody LS-C750195 is an unconjugated rabbit polyclonal antibody to human NCKX5 (SLC24A5). Validated for IF.
- Application
- IF
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Ion transporter JSX | NCKX5 | SLC24A5 | JSX | SHEP4
- UniProt Number
- Q71RS6
- NCBI GenBank
- NM_205850 | NP_995322.1
- SwissProt
- Q71RS6
Recommended Dilution
| Application | Dilution |
|---|---|
| IF/ICC | 1:50 - 1:200 |
Target
- Target
- Human SLC24A5 / NCKX5
- Antigen Species
- Human
- Gene Name
- SLC24A5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human SLC24A5 (NP_995322.1). INQYIIKKCSPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSISLHGLSQVSEDPPSVFNMPE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
