Western blot analysis of extracts of various cells.
SLC1A2 / EAAT2 / GLT-1 Antibody (aa495-574)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408264-20
Catalog Number: LS-C408264
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GLT-1 antibody LS-C408264 is an unconjugated rabbit polyclonal antibody to GLT-1 (SLC1A2 / EAAT2) (aa495-574) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EAAT-2 | GLT-1 | Glutamate transporter 1 | SLC1A2 | EAAT2 | GLT1
- Recommended Dilution: WB
- 1:500 - 1:5000
- UniProt Number
- P43004
- NCBI GenBank
- NM_004171 | NP_004162.2
- SwissProt
- P43004
Target
- Target
- Human SLC1A2 / EAAT2 / GLT-1
- Antigen Species
- Human
- Epitope
- Human SLC1A2 / EAAT2 / GLT-1
- Gene Name
- SLC1A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 495-574 of human SLC1A2 (NP_004162.2). HLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS