Western blot - Anti-SLC18A3/Vacht Picoband Antibody
SLC18A3 / VACHT Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662224-100
Catalog Number: LS-C662224
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- VACHT antibody LS-C662224 is an unconjugated rabbit polyclonal antibody to human VACHT (SLC18A3). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HVAChT | VACHT | RVAChT | SLC18A3 | Vesicular ACh transporter
- UniProt Number
- Q16572
- NCBI GenBank
- NM_003055 | NP_003046.2
- SwissProt
- Q16572
Target
- Target
- Human SLC18A3 / VACHT
- Antigen Species
- Human
- Epitope
- Peripheral and central cholinergic nervous systems. .
- Gene Name
- SLC18A3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human SLC18A3 (1-36 aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL), different from the related mouse and rat sequences by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl