Western blot analysis of extracts of various cell lines, using SLC16A3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.

SLC16A3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C497257-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SLC16A3 antibody LS-C497257 is an unconjugated rabbit polyclonal antibody to SLC16A3 from human. It is reactive with human and rat. Validated for WB.
Application: IHC, WB
Reactivity: Hu, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: MCT 3 | MCT-4 | MCT3 | MCT4 | Monocarboxylate transporter 4 | SLC16A3 | MCT-3 | Monocarboxylate transporter 3 | MCT 4
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: O15427
NCBI GenBank: NM_004207 | NP_004198.1
SwissProt: O15427

Target

Target: Human SLC16A3
Antigen Species: Human
Gene Name: SLC16A3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 371-465 of human SLC16A3 (NP_004198.1). PPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)