
SLC10A1 / NTCP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490419-100
Catalog Number: LS-C490419
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NTCP antibody LS-C490419 is an unconjugated rabbit polyclonal antibody to NTCP (SLC10A1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Growth-inhibiting protein 29 | Na(+)/bile acid cotransporter | Sodium/bile acid cotransporter | Na+/bile acid cotransporter | NTCP | NTCP1 | SLC10A1
- UniProt Number
- Q14973
- NCBI GenBank
- NM_003049 | NP_003040.1
- SwissProt
- Q14973
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human SLC10A1 / NTCP
- Antigen Species
- Human
- Gene Name
- SLC10A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
