Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of human 1) SGC-7901 and 2) SK-OV-3 cell lysate with SKP2 antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa.
SKP2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782084-100
Catalog Number: LS-C782084
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SKP2 antibody LS-C782084 is an unconjugated rabbit polyclonal antibody to human SKP2. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- F-box/LRR-repeat protein 1 | FBL1 | FLB1 | F-box protein Skp2 | FBXL1 | p45 | p45skp2 | SKP2
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q13309
- NCBI GenBank
- NM_005983 | NP_005974.2
- SwissProt
- Q13309
Target
- Target
- Human SKP2
- Antigen Species
- Human
- Gene Name
- SKP2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL were used as the immunogen for the SKP2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
