Western blot analysis of extracts of various cell lines.
SIRT6 / Sirtuin 6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C349129-20
Catalog Number: LS-C349129
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Sirtuin 6 antibody LS-C349129 is an unconjugated rabbit polyclonal antibody to Sirtuin 6 (SIRT6) from mouse. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- SIR2-like protein 6 | Sirtuin type 6 | SIR2L6 | Sir2-related protein type 6 | Sirtuin 6 | SIRT6
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q8N6T7
- NCBI GenBank
- NM_016539 | NP_057623.2
- SwissProt
- Q8N6T7
Target
- Target
- Mouse SIRT6 / Sirtuin 6
- Antigen Species
- Mouse
- Epitope
- Human SIRT6 / Sirtuin 6
- Gene Name
- SIRT6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of mouse SIRT6 (NP_001156902.1). NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS