
Western blot analysis of extract of various cells.
SIK2 / SNF1LK2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409857-20
Catalog Number: LS-C409857
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SNF1LK2 antibody LS-C409857 is an unconjugated rabbit polyclonal antibody to SNF1LK2 (SIK2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- KIAA0781 | LOH11CR1I | SNF1LK2 | QIK | Qin-induced kinase | Salt-inducible kinase 2 | SIK-2 | SIK2 | SNF1-like kinase 2
- UniProt Number
- Q9H0K1
- NCBI GenBank
- AB018324 | BAA34501.3
- SwissProt
- Q9H0K1
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human SIK2 / SNF1LK2
- Antigen Species
- Human
- Epitope
- Human SIK2 / SNF1LK2
- Gene Name
- SIK2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 827-926 of human SIK2 (NP_056006.1). PPPPPPRQPGAAPAPLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCEMLDAVDPQHNGYVLVN
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
