
Western blot testing of human 1) HeLa, 2) COLO-320, 3) SHG-44 and 4) HEK293 lysate with Sucrase Isomaltase antibody at 0.5ug/ml. Predicted molecular weight ~209 kDa.
SI / Sucrase Isomaltase Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782271-100
Catalog Number: LS-C782271
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Sucrase Isomaltase antibody LS-C782271 is an unconjugated rabbit polyclonal antibody to Sucrase Isomaltase (SI) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Alpha-glucosidase | Sucrase-isomaltase | SI | Sucrase-isomaltase, intestinal
- UniProt Number
- P14410
- NCBI GenBank
- NM_001041 | NP_001032.2
- SwissProt
- P14410
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human SI / Sucrase Isomaltase
- Antigen Species
- Human
- Gene Name
- SI
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
