Western blot testing of human 1) MCF7, 2) COLO320 and 3) HepG2 cell lysate with SFTPB antibody at 0.5ug/ml. Predicted molecular weight ~42 kDa.
SFTPB / Surfactant Protein B Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782097-100
Catalog Number: LS-C782097
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Surfactant Protein B antibody LS-C782097 is an unconjugated rabbit polyclonal antibody to human Surfactant Protein B (SFTPB). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Predicted Reactivity
- Mouse, Rat
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 6 kDa protein | PSP-B | SFTP3 | SP-B | SFTB3 | SFTPB | SMDP1 | Surfactant protein B
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P07988
- NCBI GenBank
- NM_000542 | NP_000533.3
- SwissProt
- P07988
Target
- Target
- Human SFTPB / Surfactant Protein B
- Antigen Species
- Human
- Gene Name
- SFTPB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QCLAERYSVILLDTLLGRMLPQLVCRLVLR were used as the immunogen for the SFTPB antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS