Western blot - Anti-SFTPB/Surfactant Protein B Picoband antibody
SFTPB / Surfactant Protein B Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662775-100
Catalog Number: LS-C662775
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Surfactant Protein B antibody LS-C662775 is an unconjugated rabbit polyclonal antibody to human Surfactant Protein B (SFTPB). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 6 kDa protein | PSP-B | SFTP3 | SP-B | SFTB3 | SFTPB | SMDP1 | Surfactant protein B
- UniProt Number
- P07988
- NCBI GenBank
- NM_000542 | NP_000533.3
- SwissProt
- P07988
Target
- Target
- Human SFTPB / Surfactant Protein B
- Antigen Species
- Human
- Gene Name
- SFTPB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human SFTPB (QCLAERYSVILLDTLLGRMLPQLVCRLVLR).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl