Western blot analysis of extracts of Raji cell lines.
SFRS7 / 9G8 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408813-20
Catalog Number: LS-C408813
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- 9G8 antibody LS-C408813 is an unconjugated rabbit polyclonal antibody to 9G8 (SFRS7) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 9G8 | Aging-associated protein 3 | AAG3 | Splicing factor 9G8 | RBM37 | SFRS7 | SRSF7 | ZCCHC20 | ZCRB2 | HSSG1 | SR splicing factor 7
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q16629
- SwissProt
- Q16629
Target
- Target
- Human SFRS7 / 9G8
- Antigen Species
- Human
- Epitope
- Human SFRS7 / 9G8
- Gene Name
- SRSF7
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human CXCR5 (NP_001707.1). LPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS