
SERPINB4 / SCCA1+2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750286-20
Catalog Number: LS-C750286
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SCCA1+2 antibody LS-C750286 is an unconjugated rabbit polyclonal antibody to SCCA1+2 (SERPINB4) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PI-11 | LEUPIN | SCCA2/SCCA1 fusion protein | Serpin B4 | PI11 | SCCA-2 | SCCA1 | Peptidase inhibitor 11 | SCCA2 | SERPINB4
- UniProt Number
- P48594
- SwissProt
- P48594
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:200 - 1:2000 |
Target
- Target
- Human SERPINB4 / SCCA1+2
- Antigen Species
- Human
- Gene Name
- SERPINB4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human SERPINB4 (NP_002965.1). RTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
