
Western blot analysis of extracts of various cell lines, using SEPT4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
SEPT4 / Septin 4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C496946-20
Catalog Number: LS-C496946
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Septin 4 antibody LS-C496946 is an unconjugated rabbit polyclonal antibody to Septin 4 (SEPT4) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Brain protein H5 | ARTS | BRADEION | CE5B3 | Cerebral protein 7 | H5 | HCDCREL-2 | Peanut-like 2 (Drosophila) | PNUTL2 | SEP4 | SEPT4 | Septin 4 | Bradeion beta | CE5B3 beta | Hucep-7 | MART | Peanut-like protein 2 | Septin-4 | Septin-M
- UniProt Number
- O43236
- NCBI GenBank
- NM_004574 | NP_004565.1
- SwissProt
- O43236
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:200 - 1:2000 |
Target
- Target
- Human SEPT4 / Septin 4
- Antigen Species
- Human
- Gene Name
- SEPTIN4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SEPT4 (NP_536341.1). MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
