Western blot analysis of extract of various cells.
SEMA4C / Semaphorin 4C Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409760-20
Catalog Number: LS-C409760
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Semaphorin 4C antibody LS-C409760 is an unconjugated rabbit polyclonal antibody to Semaphorin 4C (SEMA4C) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- M-Sema F | SEMAF | SEMACL1 | Semaphorin-4C | SEMA4C | KIAA1739 | M-SEMA-F | SEMAI
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9C0C4
- NCBI GenBank
- NM_017789 | NP_060259.4
- SwissProt
- Q9C0C4
Target
- Target
- Human SEMA4C / Semaphorin 4C
- Antigen Species
- Human
- Epitope
- Human SEMA4C / Semaphorin 4C
- Gene Name
- SEMA4C
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 749-833 of human SEMA4C (NP_060259.4). HARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS