Western blot testing of 1) rat kidney and 2) human SKOV3 lysate with SCTR antibody at 0.5ug/ml. Expected molecular weight: 50-64 kDa depending on glycosylation level.
SCTR / SR / Secretin Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781896-100
Catalog Number: LS-C781896
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Secretin Receptor antibody LS-C781896 is an unconjugated rabbit polyclonal antibody to Secretin Receptor (SCTR / SR) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Secretin receptor | SR | SCT-R | SCTR
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P47872
- NCBI GenBank
- AAH35757.2 | NM_002980
- SwissProt
- P47872
Target
- Target
- Human SCTR / SR / Secretin Receptor
- Antigen Species
- Human
- Gene Name
- SCTR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS