Western blot testing of 1) human placenta, 2) human U-87 MG, 3) monkey COS-7, 4) human U-20 OS, 5) human HEK293, 6) human SHG-44, 7) human K562 and 8) human HL-60 cell lysate with SCN4B antibody at 0.5ug/ml. Predicted molecular weight: 25-38 kDa depending on level of glycosylation.

SCN4B Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782301-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SCN4B antibody LS-C782301 is an unconjugated rabbit polyclonal antibody to SCN4B from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: LQT10 | Navbeta4 | Sodium channel subunit beta-4 | SCN4B
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q8IWT1
SwissProt: Q8IWT1

Target

Target: Human SCN4B
Antigen Species: Human
Gene Name: SCN4B

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ from the human protein were used as the immunogen for the SCN4B antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS