
SCGB2A1 / Mammaglobin B Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747511-20
Catalog Number: LS-C747511
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Mammaglobin B antibody LS-C747511 is an unconjugated rabbit polyclonal antibody to human Mammaglobin B (SCGB2A1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Lacryglobin | Mammaglobin-2 | Mammaglobin B | MGB2 | LIPHC | Lipophilin-C | Mammaglobin 2 | UGB3 | SCGB2A1 | Lipophilin C | LPHC | Mammaglobin-B
- UniProt Number
- O75556
- NCBI GenBank
- NM_002407 | NP_002398.1
- SwissProt
- O75556
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human SCGB2A1 / Mammaglobin B
- Antigen Species
- Human
- Gene Name
- SCGB2A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SCGB2A1 (NP_002398.1). MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
