Western blot - Anti-SAFB Picoband Antibody
SAFB1 / SAFB Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662377-100
Catalog Number: LS-C662377
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SAFB antibody LS-C662377 is an unconjugated rabbit polyclonal antibody to human SAFB (SAFB1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HAP | HET | Scaffold attachment factor B | SAB-B1 | SAFB1 | SAF-B | SAF-B1 | Scaffold attachment factor B1 | Hsp27 ERE-TATA binding protein | HSP27 ERE-TATA-binding protein | SAFB
- UniProt Number
- Q15424
- NCBI GenBank
- NM_002967 | NP_002958.2
- SwissProt
- Q15424
Target
- Target
- Human SAFB1 / SAFB
- Antigen Species
- Human
- Epitope
- Ubiquitous. Expressed at high levels in the CNS and at low levels in the liver. Expressed in a wide number of breast cancer cell lines.
- Gene Name
- SAFB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SAFB (715-754 aa DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR), different from the related mouse and rat sequences by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl