Western blot analysis of A375 cell lysate.
S100B / S100 Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331058-20
Catalog Number: LS-C331058
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- S100 Beta antibody LS-C331058 is an unconjugated rabbit polyclonal antibody to S100 Beta (S100B) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- NEF | S100B | Protein S100-B | S100 | S100 calcium binding protein B | S100 calcium-binding protein B | S100beta | S-100 protein beta chain | S-100 protein subunit beta | S100-B
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P04271
- NCBI GenBank
- NM_006272 | NP_006263.1
- SwissProt
- P04271
Target
- Target
- Human S100B / S100 Beta
- Antigen Species
- Human
- Epitope
- Human S100B / S100
- Gene Name
- S100B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100B (NP_006263.1). MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS