
Western blot analysis of extracts of THP-1 cell lines.
S100A8 / MRP8 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331639-20
Catalog Number: LS-C331639
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MRP8 antibody LS-C331639 is an unconjugated rabbit polyclonal antibody to MRP8 (S100A8) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
- Application
- IF, IHC, IHC-P, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 60B8AG | CFAG | CAGA | Calgranulin A | Calgranulin-A | Calprotectin L1L subunit | Cystic fibrosis antigen | CGLA | L1Ag | NIF | p8 | Protein S100-A8 | MRP8 | Urinary stone protein band A | CP-10 | MA387 | MRP-8 | S100A8
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P05109
- NCBI GenBank
- NM_002964 | NP_002955.2
- SwissProt
- P05109
Target
- Target
- Human S100A8 / MRP8
- Antigen Species
- Human
- Epitope
- Human S100A8 / MRP8
- Gene Name
- S100A8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human S100A8 (NP_002955.2). MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 4.445 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
