Western blot analysis of extracts of various cell lines, using S100A2 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.

S100A2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C747735-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: S100A2 antibody LS-C747735 is an unconjugated rabbit polyclonal antibody to S100A2 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CAN19 | Protein S-100L | Protein S100-A2 | S100A2 | S100L
Recommended Dilution: WB: 1:1000 - 1:2000
UniProt Number: P29034
NCBI GenBank: NM_005978 | NP_005969.1
SwissProt: P29034

Target

Target: Human S100A2
Antigen Species: Human
Gene Name: S100A2

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A2 (NP_005969.1). MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)