Flow Cytometry analysis of U251 cells using anti-GPCR LGR8 antibody. Overlay histogram showing U251 cells stained with anti-GPCR LGR8 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-GPCR LGR8 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
RXFP2 / LGR8 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Frozen, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756591-100
Catalog Number: LS-C756591
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LGR8 antibody LS-C756591 is an unconjugated rabbit polyclonal antibody to human LGR8 (RXFP2). Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC-F, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- G-protein coupled receptor 106 | GPR106 | INSL3R | LGR8 | GREAT | Relaxin receptor 2 | RXFP2 | LGR8.1 | RXFPR2
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IF/ICC
- 0.5 - 1 µg/ml
- Recommended Dilution: IHC-F
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- Q8WXD0
- NCBI GenBank
- NM_130806 | NP_570718.1
- SwissProt
- Q8WXD0
Target
- Target
- Human RXFP2 / LGR8
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- RXFP2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl