
Western blot testing of rat PC-12 cell lysate with Relaxin antibody at 0.5ug/ml. Predicted molecular weight ~21 kDa.
RLN1 / Relaxin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782046-100
Catalog Number: LS-C782046
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Relaxin antibody LS-C782046 is an unconjugated rabbit polyclonal antibody to Relaxin (RLN1) from human. It is reactive with human and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BA12D24.3.2 | H1 | Prorelaxin H1 | Preprorelaxin H1 | Relaxin 1 | Relaxin H1 | RLXH1 | Relaxin | BA12D24.3.1 | Relaxin 1 (H1) | RLN1
- UniProt Number
- P04808
- NCBI GenBank
- NM_006911 | NP_008842.1
- SwissProt
- P04808
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human RLN1 / Relaxin
- Antigen Species
- Human
- Gene Name
- RLN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids VAAKWKDDVIKLCGRELVRAQIAICGMSTWS were used as the immunogen for the Relaxin antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
