Western blot testing of 1) rat liver, 2) mouse liver and 3) human SMMC-7721 lysate with Regucalcin antibody at 0.5ug/ml. Predicted molecular weight ~33 kDa.
RGN / Regucalcin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782115-100
Catalog Number: LS-C782115
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Regucalcin antibody LS-C782115 is an unconjugated rabbit polyclonal antibody to Regucalcin (RGN) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Gluconolactonase | GNL | Regucalcin | RGN | Senescence marker protein 30 | Senescence marker protein-30 | SMP-30 | SMP30 | RC
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q15493
- NCBI GenBank
- NM_004683 | NP_004674.1
- SwissProt
- Q15493
Target
- Target
- Human RGN / Regucalcin
- Antigen Species
- Human
- Gene Name
- RGN
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS