RETN / Resistin Antibody (aa33-90)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Human |
| Format: | Lyophilized |
$465.00each
Catalog Number: LS-C131849-20
Catalog Number: LS-C131849
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Resistin antibody LS-C131849 is an unconjugated rabbit polyclonal antibody to human Resistin (RETN) (aa33-90). Validated for ELISA.
- Application
- ELISA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADSF | Fizz3 | Resistin | RETN1 | RETN | Xcp1 | RSTN | Found in inflammatory zone 3 | HXCP1 | Resistin delta2
- UniProt Number
- Q9HD89
- NCBI GenBank
- NM_020415|NP_065148.1
- SwissProt
- Q9HD89
Target
- Target
- Human RETN / Resistin
- Antigen Species
- Human
- Epitope
- Recognizes human Resistin (aa 33-90).
- Gene Name
- RETN
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic human Resistin (aa 33-90) bTG-conjugated(CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Marmoset, Cat, Dog, Pig (90%); Bovine, Horse (87%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 50 mM Tris, pH 7.2
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- 50 mm tris