c-Rel antibody Western blot. All lanes: Anti c-Rel at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 69 kD. Observed band size: 69 kD.
REL / C-Rel Antibody (aa268-306)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407953-100
Catalog Number: LS-C407953
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- C-Rel antibody LS-C407953 is an unconjugated rabbit polyclonal antibody to C-Rel (REL) (aa268-306) from mouse. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-Rel | C-Rel proto-oncogene protein | I-Rel | Proto-oncogene c-Rel | REL
- UniProt Number
- Q04864
- NCBI GenBank
- NM_002908 | NP_002899.1
- SwissProt
- Q04864
Target
- Target
- Mouse REL / C-Rel
- Antigen Species
- Mouse
- Gene Name
- REL
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306 aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl