
Western blot analysis of extracts of HeLa cells, using RBM26 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
RBM26 / SE70 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C748180-20
Catalog Number: LS-C748180
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SE70 antibody LS-C748180 is an unconjugated rabbit polyclonal antibody to human SE70 (RBM26). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ARRS2 | CTCL tumor antigen se70-2 | RBM26 | RP11-255E21.1 | RNA-binding motif protein 26 | RNA binding motif protein 26 | SE70-2 | ZC3H17 | C13orf10 | PRO1777 | RNA-binding protein 26
- UniProt Number
- Q5T8P6
- NCBI GenBank
- NM_022118 | NP_071401.3
- SwissProt
- Q5T8P6
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:1000 - 1:2000 |
Target
- Target
- Human RBM26 / SE70
- Antigen Species
- Human
- Gene Name
- RBM26
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3). TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
