RbAp48 antibody Western blot. All lanes: Anti RbAp48 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: Mouse Lung Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: JURKAT Whole Cell Lysate at 40 ug. Predicted band size: 54 kD. Observed band size: 54 kD.
RBBP4 / RBAP48 Antibody (aa395-425)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Chicken, Dog, Guinea Pig, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408009-100
Catalog Number: LS-C408009
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RBAP48 antibody LS-C408009 is an unconjugated rabbit polyclonal antibody to RBAP48 (RBBP4) (aa395-425) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Ck, GP, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CAF-I p48 | CAF-1 subunit C | CAF-I 48 kDa subunit | MSI1 protein homolog | Histone-binding protein RBBP4 | NURF55 | RBBP-4 | RBAP48 | RBBP4
- UniProt Number
- Q09028
- NCBI GenBank
- NM_005610 | NP_005601.1
- SwissProt
- Q09028
Target
- Target
- Human RBBP4 / RBAP48
- Antigen Species
- Human
- Gene Name
- RBBP4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human RbAp48 (395-425 aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl