
Western blot testing of 1) rat brain and 2) mouse brain lysate with RanBP2 antibody at 0.5ug/ml. Predicted molecular weight ~358 kDa, observed here at ~270 kDa.
RANBP2 / TRP1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782033-100
Catalog Number: LS-C782033
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TRP1 antibody LS-C782033 is an unconjugated rabbit polyclonal antibody to TRP1 (RANBP2) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 358 kDa nucleoporin | ANE1 | E3 SUMO-protein ligase RanBP2 | IIAE3 | Nucleoporin Nup358 | NUP358 | Nucleoporin 358 | RANBP2 | Ran-binding protein 2 | TRP1 | p270 | RAN binding protein 2 | TRP2
- UniProt Number
- P49792
- NCBI GenBank
- NM_006267 | NP_006258.3
- SwissProt
- P49792
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Mouse RANBP2 / TRP1
- Antigen Species
- Mouse
- Gene Name
- RANBP2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 3018-3057 (EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE) were used as the immunogen for the RanBP2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
