Western blot testing of 1) human MDA-MB-453, 2) human SK-OV-3, 3) human A431, 4) rat testis, 5) mouse brain and 6) mouse HEPA1-6 lysate with RAB6A antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa.
RAB6A / RAB6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782129-100
Catalog Number: LS-C782129
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RAB6 antibody LS-C782129 is an unconjugated rabbit polyclonal antibody to RAB6 (RAB6A) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Rab GTPase | Rab-6 | RAB6 | Ras-related protein rab-6 | RAB6A' | Ras-related protein Rab-6A | RAB6A
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P20340
- NCBI GenBank
- NM_002869 | NP_002860.2
- SwissProt
- P20340
Target
- Target
- Human RAB6A / RAB6
- Antigen Species
- Human
- Gene Name
- RAB6A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE from the human protein were used as the immunogen for the RAB6A antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS