Western blot analysis of RAB6A using anti-RAB6A antibody
RAB6A / RAB6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662949-100
Catalog Number: LS-C662949
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RAB6 antibody LS-C662949 is an unconjugated rabbit polyclonal antibody to human RAB6 (RAB6A). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Rab GTPase | Rab-6 | RAB6 | Ras-related protein rab-6 | RAB6A' | Ras-related protein Rab-6A | RAB6A
- UniProt Number
- P20340
- NCBI GenBank
- NM_002869 | NP_002860.2
- SwissProt
- P20340
Target
- Target
- Human RAB6A / RAB6
- Antigen Species
- Human
- Epitope
- Ubiquitous.
- Gene Name
- RAB6A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl