Western blot analysis of extracts of various cell lines, using RAB39A antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

RAB39 / RAB39A Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

See all Human RAB39 / RAB39A Antibodies →

$281.00each

Catalog Number: LS-C747388-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: RAB39A antibody LS-C747388 is an unconjugated rabbit polyclonal antibody to RAB39A (RAB39) from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Rab-39 | RAB39A | Ras-related protein Rab-39A | RAB39
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q14964
NCBI GenBank: BC028064
SwissProt: Q14964

Target

Target: Human RAB39 / RAB39A
Antigen Species: Hu
Gene Name: RAB39A

Antibody

Host Species: Rb
Clonality: Polyclonal
Isotype: IgG
Origin Species: Hu

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-170 of human RAB39A (NP_059986.1). SFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTI
Immunogen Type: Fusion-P