
Western blot testing of human 1) MCF7 and 2) MM453 lysate with Nectin-4 antibody at 0.5ug/ml. Expected molecular weight ~55 kDa (unmodified), ~66 kDa (glycosylated).
PVRL4 / Nectin 4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781892-100
Catalog Number: LS-C781892
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Nectin 4 antibody LS-C781892 is an unconjugated rabbit polyclonal antibody to human Nectin 4 (PVRL4). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EDSS1 | Nectin 4 | Ig superfamily receptor LNIR | Poliovirus receptor-like 4 | LNIR | Nectin-4 | Poliovirus receptor-related 4 | PVRL4
- UniProt Number
- Q96NY8
- NCBI GenBank
- NM_030916 | NP_112178.2
- SwissProt
- Q96NY8
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human PVRL4 / Nectin 4
- Antigen Species
- Human
- Gene Name
- NECTIN4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
