Western blot analysis of Nectin-4/PVRL4 expression in MCF-7 whole cell lysates and MM453 whole cell lysates. Nectin-4/PVRL4 at 66KD was detected using rabbit anti-Nectin-4/PVRL4 Antigen Affinity purified polyclonal antibody at 0.5 ug/ml. The blot was developed using chemiluminescence (ECL) method.
PVRL4 / Nectin 4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662971-100
Catalog Number: LS-C662971
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Nectin 4 antibody LS-C662971 is an unconjugated rabbit polyclonal antibody to human Nectin 4 (PVRL4). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EDSS1 | Nectin 4 | Ig superfamily receptor LNIR | Poliovirus receptor-like 4 | LNIR | Nectin-4 | Poliovirus receptor-related 4 | PVRL4
- UniProt Number
- Q96NY8
- NCBI GenBank
- NM_030916 | NP_112178.2
- SwissProt
- Q96NY8
Target
- Target
- Human PVRL4 / Nectin 4
- Antigen Species
- Human
- Epitope
- Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma. .
- Gene Name
- NECTIN4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Nectin-4/PVRL4 (53-94 aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl