LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.

PTPRF Antibody (aa1167-1203)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407998-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: PTPRF antibody LS-C407998 is an unconjugated rabbit polyclonal antibody to human PTPRF (aa1167-1203). Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: LAR | LCA-homolog | Ptp-lar | PTPRF
UniProt Number: P10586
NCBI GenBank: NM_002840 | NP_002831.2
SwissProt: P10586

Target

Target: Human PTPRF
Antigen Species: Human
Gene Name: PTPRF

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203 aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK), different from the related mouse and rat sequences by four amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl